PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g111290.2
Common NameMTR_7g111290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 340aa    MW: 37894.7 Da    PI: 5.5695
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g111290.2genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.66.6e-142568146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     rg+++++E+  +++++++lG++ W+ Ia+ ++ gRt++++k+ w++
  Medtr7g111290.2 25 RGAFSEQEENSIIELHALLGNR-WSQIAAQLP-GRTDNEIKNLWNS 68
                     89********************.*********.*********9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.391119IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.6E-10530IPR009057Homeodomain-like
SuperFamilySSF466895.85E-20679IPR009057Homeodomain-like
PROSITE profilePS5129423.9482074IPR017930Myb domain
SMARTSM007172.6E-122472IPR001005SANT/Myb domain
PfamPF002493.4E-132568IPR001005SANT/Myb domain
CDDcd001674.55E-92767No hitNo description
Gene3DG3DSA:1.10.10.602.8E-203175IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MSGLQRCGKS CRLRWINYLR PDLKRGAFSE QEENSIIELH ALLGNRWSQI AAQLPGRTDN  60
EIKNLWNSSL KKKLKQKGID PNTHQPFSEN NDNDTPNIQI QKTSVGSNEV KNLFDDTPNP  120
NSIPMDNCNY PLEINSKINN SVNCFIPCDN MVGLGGGSYL NFQQLNYGIN NMTLSPPNSN  180
SNTSLCFIPS TSGSTSTCSQ MMSELNSSTM FHSMYTNHPS NSISSGEVDG IQNWEFGASK  240
SSNGSSINNY LDHQVVEDIK WSDYINSTPF FLGNNNTFQQ TTTSTHSSIY EVKQEMGGFI  300
NTNESIQSSS STWHPHFEAD IYSNKDLQRF SLAFGQTLN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-2267440108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16975LKKKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1578940.0AC157894.3 Medicago truncatula chromosome 7 clone mth2-85d15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013450425.10.0myb transcription factor
TrEMBLA0A072U5Q00.0A0A072U5Q0_MEDTR; Myb transcription factor
STRINGGLYMA03G38660.11e-102(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.14e-46myb domain protein 61
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]